Strengths and box codes
| Strength | Box code | Pack | Availability |
|---|---|---|---|
| 0.1 mg | IGF-01 | Box of 10 vials | Pre-order |
| 1 mg | IGF-1 | Box of 10 vials | Pre-order |
Supplied as a freeze-dried (lyophilised) powder in a sealed vial. There is no minimum order for delivery in the UAE.
Every product in our range is supplied to order. You can pre-order it: nothing is charged at that stage, and it arrives within 14 days of confirmation.
Identity
| Name | IGF-1 LR3 (also Long R3 IGF-I, LR3-IGF-1) |
| Sequence, three-letter | Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala |
| Sequence, one-letter | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Length | 83 amino acids |
| Molecular formula | C₄₀₀H₆₁₉N₁₁₁O₁₁₅S₉ |
| Molecular weight | 9111.45 g/mol (monoisotopic mass 9105.3487) |
| CAS number | 946870-92-4 |
| UniProt | P05019 |
Reference data: calculated from the sequence. The certificate for the batch is the authority for the material you receive. You can check a certificate's mass against the sequence with our peptide calculator.
Documents with every batch
- The manufacturer's certificate of analysis, with the batch number, the purity by HPLC and the identity by mass spectrometry.
- Batch number and expiry date on the vial, the box and the delivery note.
- Safety data sheet: on request.
Ask for the certificate of the current batch before you order. How to read a certificate of analysis
Storage
Store as stated on the label. Keep the vial sealed, dry and away from light until it is needed. Our storage and handling guide explains what matters and why.
Ordering in the UAE
- Send the box codes and quantities with your trade licence, by the quote form.
- For a first order of research-grade products, sign the end-use declaration.
- We send a quotation, valid for 14 days. Payment is in full before dispatch unless other terms are agreed in writing.
- Delivery to your laboratory or business address, with the certificate and a delivery note.
We supply businesses and institutions only, and we give no advice on doses or use. All research-grade peptides
Questions buyers ask
- What is IGF-1 LR3 used for?
As we supply it: laboratory research, and nothing else. We do not describe effects or uses in people. Research use only, explained
- What is the sequence of IGF-1 LR3?
Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala (MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA), 83 amino acids.
- What is the CAS number of IGF-1 LR3?
946870-92-4.
- Is IGF-1 LR3 in stock?
It is supplied to order: pre-order it and it arrives within 14 days of confirmation. Nothing is charged until we confirm the order.
- What does IGF-1 LR3 cost?
We quote per order: send the box codes and quantities.
- Can individuals buy IGF-1 LR3 from you?
No. We supply verified laboratories and businesses only.