Skip to content

Trade supply in the UAE. We sell to businesses and institutions only, and give no advice on doses or use.

Emirate Peptides
Menu
Request a quote
LL-37 5 mg vial, labelled for research use only

LL-37 5 mgBox code LL375

Pre-order: delivered within 14 days of confirmation. Nothing is charged when you pre-order.

Pre-order
Research gradePre-order

LL-37, research grade

LL-37 is a peptide of 37 amino acids: residues 134 to 170 of the human cathelicidin precursor, made by synthesis. Its name comes from its first two residues, both leucine, and its length. We supply it as a research-grade material to verified laboratories and business buyers in Dubai and across the UAE.

For laboratory research use only. Not for human or veterinary use. Not a medicine.

Pre-orderRequest a quoteWho can buy from us
Pack
Box of 10 vials
Box codes
LL375
Label
For laboratory research use only. Not for human or veterinary use.

Strengths and box codes

StrengthBox codePackAvailability
5 mgLL375Box of 10 vialsPre-order

Supplied as a freeze-dried (lyophilised) powder in a sealed vial. There is no minimum order for delivery in the UAE.

Every product in our range is supplied to order. You can pre-order it: nothing is charged at that stage, and it arrives within 14 days of confirmation.

Identity

NameLL-37 (also human cathelicidin LL-37)
Sequence, three-letterLeu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Sequence, one-letterLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Length37 amino acids
Molecular formulaC₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight4493 g/mol (monoisotopic mass 4490.5754)
CAS number154947-66-7
UniProtP49913

Reference data: PubChem CID 16198951. The certificate for the batch is the authority for the material you receive. You can check a certificate's mass against the sequence with our peptide calculator.

Documents with every batch

  • The manufacturer's certificate of analysis, with the batch number, the purity by HPLC and the identity by mass spectrometry.
  • Batch number and expiry date on the vial, the box and the delivery note.
  • Safety data sheet: on request.

Ask for the certificate of the current batch before you order. How to read a certificate of analysis

Storage

Store as stated on the label. Keep the vial sealed, dry and away from light until it is needed. Our storage and handling guide explains what matters and why.

Ordering in the UAE

  1. Send the box codes and quantities with your trade licence, by the quote form.
  2. For a first order of research-grade products, sign the end-use declaration.
  3. We send a quotation, valid for 14 days. Payment is in full before dispatch unless other terms are agreed in writing.
  4. Delivery to your laboratory or business address, with the certificate and a delivery note.

We supply businesses and institutions only, and we give no advice on doses or use. All research-grade peptides

Questions buyers ask

What is LL-37 used for?

As we supply it: laboratory research, and nothing else. We do not describe effects or uses in people. Research use only, explained

What is the sequence of LL-37?

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa]), 37 amino acids.

What is the CAS number of LL-37?

154947-66-7.

Is LL-37 in stock?

It is supplied to order: pre-order it and it arrives within 14 days of confirmation. Nothing is charged until we confirm the order.

What does LL-37 cost?

We quote per order: send the box codes and quantities.

Can individuals buy LL-37 from you?

No. We supply verified laboratories and businesses only.