Strengths and box codes
| Strength | Box code | Pack | Availability |
|---|---|---|---|
| 5 mg | SMO5 | Box of 10 vials | Pre-order |
| 10 mg | SMO10 | Box of 10 vials | Pre-order |
Supplied as a freeze-dried (lyophilised) powder in a sealed vial. There is no minimum order for delivery in the UAE.
Every product in our range is supplied to order. You can pre-order it: nothing is charged at that stage, and it arrives within 14 days of confirmation.
Identity
| Name | Sermorelin acetate (also sermorelin, GRF (1-29) amide) |
| Sequence, three-letter | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ |
| Sequence, one-letter | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
| Length | 29 amino acids |
| Molecular formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molecular weight | 3357.9 g/mol (monoisotopic mass 3355.8187) |
| CAS number | 86168-78-7 |
Reference data: PubChem CID 16132413. The certificate for the batch is the authority for the material you receive. You can check a certificate's mass against the sequence with our peptide calculator.
Documents with every batch
- The manufacturer's certificate of analysis, with the batch number, the purity by HPLC and the identity by mass spectrometry.
- Batch number and expiry date on the vial, the box and the delivery note.
- Safety data sheet: on request.
Ask for the certificate of the current batch before you order. How to read a certificate of analysis
Storage
Store as stated on the label. Keep the vial sealed, dry and away from light until it is needed. Our storage and handling guide explains what matters and why.
Ordering in the UAE
- Send the box codes and quantities with your trade licence, by the quote form.
- For a first order of research-grade products, sign the end-use declaration.
- We send a quotation, valid for 14 days. Payment is in full before dispatch unless other terms are agreed in writing.
- Delivery to your laboratory or business address, with the certificate and a delivery note.
We supply businesses and institutions only, and we give no advice on doses or use. All research-grade peptides
Questions buyers ask
- What is Sermorelin acetate used for?
As we supply it: laboratory research, and nothing else. We do not describe effects or uses in people. Research use only, explained
- Is sermorelin a steroid?
No. It is a peptide of 29 amino acids. Steroids are a different class of molecule.
- What is the sequence of Sermorelin acetate?
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂), 29 amino acids.
- What is the CAS number of Sermorelin acetate?
86168-78-7.
- Is Sermorelin acetate in stock?
It is supplied to order: pre-order it and it arrives within 14 days of confirmation. Nothing is charged until we confirm the order.
- What does Sermorelin acetate cost?
We quote per order: send the box codes and quantities.
- Can individuals buy Sermorelin acetate from you?
No. We supply verified laboratories and businesses only.